ATG14L antibody orb308776 from Biorbyt

Product Specs
ItemATG14L antibody
CompanyBiorbyt
Price Pricing Info Supplier Page
Catalog Numberorb308776
Quantity10 µg, 100 µg
ApplicationsFC, ICC, IF, IHC, WB
Conjugate/TagUnconjugated
FormatLyophilized
ReactivityHuman, Rat
TargetATG14L
IsotypeRabbit IgG
HostRabbit
ImmunogenA synthetic peptide corresponding to a sequence at the N-terminus of human ATG14L (70-101aa RDRERFIDKKERLSRLKSKQEEFQKEVLKAME), different from the related mouse and rat sequences by two amino acids
NCBI Full Gene Nameautophagy related 14
NCBI Gene AliasesATG14L, BARKOR, KIAA0831
ClonalityPolyclonal
Molecular Weight55309 MW
ConcentrationAdding 0.2 ml of distilled water will yield a concentration of 500 µg/ml
StorageStore at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles

Specifications/Features

Application Notes: Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Application Dilutions: Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Rat, By HeatWestern blot, 0.1-0.5µg/ml, Human, RatImmunohistochemistry (Frozen Section), 0.5-1µg/ml, Human Immunocytochemistry, 0.5-1µg/ml, Human Flow Cytometry, 1-3µg/1x106 cells, Human

Add to Compare List